PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG083100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB_related
Protein Properties Length: 338aa    MW: 36125.9 Da    PI: 6.805
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG083100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32e-1463107147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          r +W++eE+ +++da  ++G + Wk+I +++  ++t  q++s+ qky
  Pavir.5KG083100.1.p  63 REPWSAEEHGRFLDALLMFGRD-WKKIEEHVR-TKTTIQIRSHAQKY 107
                          789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-1757113IPR009057Homeodomain-like
PROSITE profilePS5129417.58858112IPR017930Myb domain
TIGRFAMsTIGR015571.1E-1561110IPR006447Myb domain, plants
SMARTSM007176.2E-962110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-663103IPR009057Homeodomain-like
PfamPF002491.8E-1163107IPR001005SANT/Myb domain
CDDcd001676.13E-765108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGPSSSLALL GMRVRVYIVR VENQSAWVLG DSIASSSSRG EMERGDDAPG KKARKPYTIT  60
KPREPWSAEE HGRFLDALLM FGRDWKKIEE HVRTKTTIQI RSHAQKYFIK VQKLGLAAGL  120
PPAHPRRRFA MELQSSAAGS SAAAVPMLHG EPHGAPVAVP GPPDAVAHGC IGWNSPGGLP  180
AAAGGSSSEM RGLDWAGASA SGIPAWLNSD AQSQIAPPTI LPGGSQFVGT PSFSSTSMVW  240
AGSSRSGGSA IDSAQDEDEQ IELPLSPDDL HFAQVYRFVG DVFDPNTPIP VEAHLQKLRD  300
MDDITVKTIL LVLRNLENNL SAPQFEPIRR LLSSVDV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0693303e-65BT069330.2 Zea mays full-length cDNA clone ZM_BFc0100G09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971681.11e-156PREDICTED: protein REVEILLE 8-like isoform X2
TrEMBLC5XP981e-121C5XP98_SORBI; Putative uncharacterized protein Sb03g005480
STRINGSb03g005480.11e-121(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.12e-31MYB_related family protein